Name | LHPP Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70600 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Rabbit |
Antigen | Synthetic peptides corresponding to LHPP (phospholysine phosphohistidine inorganic pyrophosphate phosphatase) The peptide sequence was selected from the middle region of LHPP)(50ug). Peptide sequence ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVG |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | LHPP |
Supplier Page | Shop |