LHPP Antibody

Name LHPP Antibody
Supplier Novus Biologicals
Catalog NBP1-70600
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Rabbit
Antigen Synthetic peptides corresponding to LHPP (phospholysine phosphohistidine inorganic pyrophosphate phosphatase) The peptide sequence was selected from the middle region of LHPP)(50ug). Peptide sequence ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVG
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene LHPP
Supplier Page Shop

Product images