DHRS2 Antibody

Name DHRS2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54922
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DHRS2(dehydrogenase/reductase (SDR family) member 2) The peptide sequence was selected from the middle region of DHRS2. Peptide sequence LEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DHRS2
Conjugate Unconjugated
Supplier Page Shop

Product images