Name | GCHFR Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54960 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Pig, Horse |
Antigen | Synthetic peptides corresponding to GCHFR(GTP cyclohydrolase I feedback regulator) The peptide sequence was selected from the N terminal of GCHFR. Peptide sequence MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | GCHFR |
Supplier Page | Shop |