GCHFR Antibody

Name GCHFR Antibody
Supplier Novus Biologicals
Catalog NBP1-54960
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Pig, Horse
Antigen Synthetic peptides corresponding to GCHFR(GTP cyclohydrolase I feedback regulator) The peptide sequence was selected from the N terminal of GCHFR. Peptide sequence MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene GCHFR
Supplier Page Shop

Product images