EMI1 Antibody

Name EMI1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55050
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBXO5(F-box protein 5) The peptide sequence was selected from the C terminal of FBXO5. Peptide sequence ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXO5
Conjugate Unconjugated
Supplier Page Shop

Product images