CHMP1B Antibody

Name CHMP1B Antibody
Supplier Novus Biologicals
Catalog NBP1-55512
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CHMP1B(chromatin modifying protein 1B) Antibody(against the N terminal of CHMP1B. Peptide sequence KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CHMP1B
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.