ERCC6L Antibody

Name ERCC6L Antibody
Supplier Novus Biologicals
Catalog NBP1-56332
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ERCC6L Antibody(against the N terminal of ERCC6L. Peptide sequence GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ERCC6L
Conjugate Unconjugated
Supplier Page Shop

Product images