WDR58 Antibody

Name WDR58 Antibody
Supplier Novus Biologicals
Catalog NBP1-56356
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to THOC6(THO complex 6 homolog (Drosophila)) The peptide sequence was selected from the middle region of THOC6. Peptide sequence AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene THOC6
Conjugate Unconjugated
Supplier Page Shop

Product images