Name | WDR58 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56356 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to THOC6(THO complex 6 homolog (Drosophila)) The peptide sequence was selected from the middle region of THOC6. Peptide sequence AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | THOC6 |
Conjugate | Unconjugated |
Supplier Page | Shop |