LMAN2 Antibody
| Name | LMAN2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69474 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LMAN2(lectin, mannose-binding 2) The peptide sequence was selected from the N terminal of LMAN2. Peptide sequence SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LMAN2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LMAN2 Antibody [NBP1-69474] - This Anti-LMAN2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24270_LMAN2-Antibody-Western-Blot-NBP1-69474-img0001.jpg)
Western Blot: LMAN2 Antibody [NBP1-69474] - This Anti-LMAN2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.
![Immunohistochemistry: LMAN2 Antibody [NBP1-69474] - Human Lung Tissue Observed Staining: Cytoplasm of pneumocytes Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24271_LMAN2%2520Antibody-Immunohistochemistry-NBP1-69474-img0002.jpg)
Immunohistochemistry: LMAN2 Antibody [NBP1-69474] - Human Lung Tissue Observed Staining: Cytoplasm of pneumocytes Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.