SNRPD2 Antibody
| Name | SNRPD2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57174 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SNRPD2(small nuclear ribonucleoprotein D2 polypeptide 16.5kDa) The peptide sequence was selected from the middle region of SNRPD2. Peptide sequence ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SNRPD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SNRPD2 Antibody [NBP1-57174] - Human Jurkat, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29799_SNRPD2-Antibody-Western-Blot-NBP1-57174-img0005.jpg)
Western Blot: SNRPD2 Antibody [NBP1-57174] - Human Jurkat, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in Jurkat.
![Western Blot: SNRPD2 Antibody [NBP1-57174] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29800_SNRPD2-Antibody-Western-Blot-NBP1-57174-img0002.jpg)
Western Blot: SNRPD2 Antibody [NBP1-57174] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: SNRPD2 Antibody [NBP1-57174] - Human 293T, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in HEK293T.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29801_SNRPD2-Antibody-Western-Blot-NBP1-57174-img0003.jpg)
Western Blot: SNRPD2 Antibody [NBP1-57174] - Human 293T, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in HEK293T.
![Western Blot: SNRPD2 Antibody [NBP1-57174] - Human Hela, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29802_SNRPD2-Antibody-Western-Blot-NBP1-57174-img0004.jpg)
Western Blot: SNRPD2 Antibody [NBP1-57174] - Human Hela, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in HeLa.
![Western Blot: SNRPD2 Antibody [NBP1-57174] - Human MCF7, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in MCF7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29803_SNRPD2%2520Antibody-Western%2520Blot-NBP1-57174-img0006.jpg)
Western Blot: SNRPD2 Antibody [NBP1-57174] - Human MCF7, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in MCF7.