OSTalpha Antibody

Name OSTalpha Antibody
Supplier Novus Biologicals
Catalog NBP1-57085
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OSTalpha (organic solute transporter alpha) The peptide sequence was selected from the middle region of OSTalpha. Peptide sequence LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC51A
Conjugate Unconjugated
Supplier Page Shop

Product images