Name | SNRPD2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57173 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Zebrafish |
Antigen | Synthetic peptides corresponding to SNRPD2(small nuclear ribonucleoprotein D2 polypeptide 16.5kDa) The peptide sequence was selected from the N terminal of SNRPD2. Peptide sequence MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | SNRPD2 |
Supplier Page | Shop |