SNRPD2 Antibody

Name SNRPD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57173
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Zebrafish
Antigen Synthetic peptides corresponding to SNRPD2(small nuclear ribonucleoprotein D2 polypeptide 16.5kDa) The peptide sequence was selected from the N terminal of SNRPD2. Peptide sequence MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SNRPD2
Supplier Page Shop

Product images