CYP4F3 Antibody
| Name | CYP4F3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69678 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CYP4F3(cytochrome P450, family 4, subfamily F, polypeptide 3) The peptide sequence was selected from the N terminal of CYP4F3. Peptide sequence LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CYP4F3 |
| Supplier Page | Shop |
Product images
![Western Blot: CYP4F3 Antibody [NBP1-69678] - This Anti-CYP4F3 antibody was used in Western Blot of OVCAR-3 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4274_CYP4F3-Antibody-Western-Blot-NBP1-69678-img0001.jpg)
Western Blot: CYP4F3 Antibody [NBP1-69678] - This Anti-CYP4F3 antibody was used in Western Blot of OVCAR-3 tissue lysate at a concentration of 1ug/ml.
![Immunocytochemistry/Immunofluorescence: CYP4F3 Antibody [NBP1-69678] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes, strong signal, moderate tissue distribution](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4275_CYP4F3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-69678-img0002.jpg)
Immunocytochemistry/Immunofluorescence: CYP4F3 Antibody [NBP1-69678] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes, strong signal, moderate tissue distribution