SLC38A9 Antibody
| Name | SLC38A9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69235 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FLJ90709 The peptide sequence was selected from the middle region of FLJ90709. Peptide sequence VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC38A9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC38A9 Antibody [NBP1-69235] - This Anti-FLJ90709 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6963_SLC38A9-Antibody-Western-Blot-NBP1-69235-img0002.jpg)
Western Blot: SLC38A9 Antibody [NBP1-69235] - This Anti-FLJ90709 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.