Nuclear Factor Erythroid Derived 2 Antibody
| Name | Nuclear Factor Erythroid Derived 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69226 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Pig, Bovine |
| Antigen | Synthetic peptides corresponding to NFE2 (nuclear factor (erythroid-derived 2), 45kDa) The peptide sequence was selected from the N terminal of NFE2. Peptide sequence MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NFE2 |
| Supplier Page | Shop |
Product images
![Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-69226] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4286_Nuclear-Factor-Erythroid-Derived-2-Antibody-Western-Blot-NBP1-69226-img0004.jpg)
Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-69226] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.