SLC39A5 Antibody
| Name | SLC39A5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69296 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC39A5(solute carrier family 39 (metal ion transporter), member 5) The peptide sequence was selected from the N terminal of SLC39A5. Peptide sequence MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC39A5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SLC39A5 Antibody [NBP1-69296] - This Anti-SLC39A5 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14749_SLC39A5-Antibody-Western-Blot-NBP1-69296-img0001.jpg)
![Immunohistochemistry: SLC39A5 Antibody [NBP1-69296] - Human Liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14750_SLC39A5%2520Antibody-Immunohistochemistry-NBP1-69296-img0002.jpg)