Name | SLC39A5 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69296 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC39A5(solute carrier family 39 (metal ion transporter), member 5) The peptide sequence was selected from the N terminal of SLC39A5. Peptide sequence MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC39A5 |
Conjugate | Unconjugated |
Supplier Page | Shop |