PHF19 Antibody
| Name | PHF19 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79352 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human PHF19The immunogen for this antibody is PHF19. Peptide Sequence: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PHF19 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PHF19 Antibody [NBP1-79352] - Titration: 1 ug/ml Positive Control: HEK-293T cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24617_PHF19-Antibody-Western-Blot-NBP1-79352-img0006.jpg)
Western Blot: PHF19 Antibody [NBP1-79352] - Titration: 1 ug/ml Positive Control: HEK-293T cells.
![Western Blot: PHF19 Antibody [NBP1-79352] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24618_PHF19-Antibody-Western-Blot-NBP1-79352-img0004.jpg)
Western Blot: PHF19 Antibody [NBP1-79352] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
![Western Blot: PHF19 Antibody [NBP1-79352] - Titration: 1 ug/ml Positive Control: HBEC, A549, Calu-6, NCI358,NCI841, NCI1299, NCI1650 and NCI1975 cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24619_PHF19-Antibody-Western-Blot-NBP1-79352-img0005.jpg)
Western Blot: PHF19 Antibody [NBP1-79352] - Titration: 1 ug/ml Positive Control: HBEC, A549, Calu-6, NCI358,NCI841, NCI1299, NCI1650 and NCI1975 cells.