SLP-2 Antibody
| Name | SLP-2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79903 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The specific Immunogen is proprietary information. Peptide sequence VTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | STOML2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLP-2 Antibody [NBP1-79903] - Human 293T, Antibody Dilution: 1.0 ug/ml STOML2 is supported by BioGPS gene expression data to be expressed in HEK293T.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24320_SLP-2-Antibody-Western-Blot-NBP1-79903-img0003.jpg)
Western Blot: SLP-2 Antibody [NBP1-79903] - Human 293T, Antibody Dilution: 1.0 ug/ml STOML2 is supported by BioGPS gene expression data to be expressed in HEK293T.
![Western Blot: SLP-2 Antibody [NBP1-79903] - Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24321_SLP-2-Antibody-Western-Blot-NBP1-79903-img0002.jpg)
Western Blot: SLP-2 Antibody [NBP1-79903] - Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell.
![Western Blot: SLP-2 Antibody [NBP1-79903] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24322_SLP-2%2520Antibody-Western%2520Blot-NBP1-79903-img0004.jpg)
Western Blot: SLP-2 Antibody [NBP1-79903] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.