PAIP2 Antibody
| Name | PAIP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79620 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog |
| Antigen | The immunogen for this antibody is PAIP2. Peptide sequence MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEE. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PAIP2 |
| Supplier Page | Shop |
Product images
![Western Blot: PAIP2 Antibody [NBP1-79620] - Lane: Jurkat Cell Lysate, Antibody Titration:1 ug/ml and Gel concentration :10-20%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4420_PAIP2%2520Antibody-Western%2520Blot-NBP1-79620-img0001.jpg)
Western Blot: PAIP2 Antibody [NBP1-79620] - Lane: Jurkat Cell Lysate, Antibody Titration:1 ug/ml and Gel concentration :10-20%