RNASET2 Antibody
| Name | RNASET2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80017 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human RNASET2. Peptide sequence RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RNASET2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RNASET2 Antibody [NBP1-80017] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24378_RNASET2-Antibody-Western-Blot-NBP1-80017-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: RNASET2 Antibody [NBP1-80017] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasmic in in alveolar cells, type I and II](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24379_RNASET2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80017-img0003.jpg)