CCL18/PARC Antibody
| Name | CCL18/PARC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79940 |
| Prices | $369.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human CCL18. Peptide sequence PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CCL18 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CCL18/PARC Antibody [NBP1-79940] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29804_CCL18-PARC-Antibody-Western-Blot-NBP1-79940-img0004.jpg)
Western Blot: CCL18/PARC Antibody [NBP1-79940] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
![Immunohistochemistry-Paraffin: CCL18/PARC Antibody [NBP1-79940] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29805_CCL18-PARC-Antibody-Immunohistochemistry-Paraffin-NBP1-79940-img0002.jpg)
Immunohistochemistry-Paraffin: CCL18/PARC Antibody [NBP1-79940] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.
![Western Blot: CCL18/PARC Antibody [NBP1-79940] - Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29806_CCL18-PARC-Antibody-Western-Blot-NBP1-79940-img0001.jpg)
Western Blot: CCL18/PARC Antibody [NBP1-79940] - Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.
![Western Blot: CCL18/PARC Antibody [NBP1-79940] - Fetal Lung lysates, Antibody Dilution: 0.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29807_CCL18-PARC-Antibody-Western-Blot-NBP1-79940-img0003.jpg)
Western Blot: CCL18/PARC Antibody [NBP1-79940] - Fetal Lung lysates, Antibody Dilution: 0.5 ug/ml.