SRGN Antibody

Name SRGN Antibody
Supplier Novus Biologicals
Catalog NBP1-80447
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human SRGN. Peptide sequence RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SRGN
Conjugate Unconjugated
Supplier Page Shop

Product images