ALKBH8 Antibody

Name ALKBH8 Antibody
Supplier Novus Biologicals
Catalog NBP1-80474
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ALKBH8. Peptide sequence EEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNV.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ALKBH8
Conjugate Unconjugated
Supplier Page Shop

Product images