CYP4A22 Antibody
| Name | CYP4A22 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80495 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human CYP4A22. Peptide sequence MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CYP4A22 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CYP4A22 Antibody [NBP1-80495] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24331_CYP4A22-Antibody-Western-Blot-NBP1-80495-img0001.jpg)
Western Blot: CYP4A22 Antibody [NBP1-80495] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: CYP4A22 Antibody [NBP1-80495] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24332_CYP4A22-Antibody-Immunohistochemistry-Paraffin-NBP1-80495-img0003.jpg)
Immunohistochemistry-Paraffin: CYP4A22 Antibody [NBP1-80495] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.