Name | ZFP57 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-91550 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the N terminal of human ZFP57. Peptide sequence MFEQLKPIEPRDCWREARVKKKPVTFEDVAVNFTQEEWDCLDASQRVLYQ. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | ZFP57 |
Conjugate | Unconjugated |
Supplier Page | Shop |