ELOVL7 Antibody

Name ELOVL7 Antibody
Supplier Novus Biologicals
Catalog NBP1-91349
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ELOVL7. Peptide sequence MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ELOVL7
Conjugate Unconjugated
Supplier Page Shop

Product images