UGT1A7 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-91335
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the N terminal of human UGT1A7. Peptide sequence VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: UGT1A7
• Conjugate: Unconjugated