Heparan Sulfate Glucosamine 3-O-Sulfotransferase 3 Antibody
| Name | Heparan Sulfate Glucosamine 3-O-Sulfotransferase 3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91295 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human HS3ST3B1. Peptide sequence AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HS3ST3B1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Heparan Sulfate Glucosamine 3-O-Sulfotransferase 3 Antibody [NBP1-91295] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6880_Heparan-Sulfate-Glucosamine-3-O-Sulfotransferase-3-Antibody-Western-Blot-NBP1-91295-img0002.jpg)
![Western Blot: Heparan Sulfate Glucosamine 3-O-Sulfotransferase 3 Antibody [NBP1-91295] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6881_Heparan%2520Sulfate%2520Glucosamine%25203-O-Sulfotransferase%25203%2520Antibody-Western%2520Blot-NBP1-91295-img0003.jpg)