RAB1B Antibody
| Name | RAB1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-98500 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for this antibody is RAB1B - C-terminal region. Peptide sequence TSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RAB1B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RAB1B Antibody [NBP1-98500] - human Hela Cells and Monkey Vera.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6878_RAB1B%2520Antibody-Western%2520Blot-NBP1-98500-img0003.jpg)
![Western Blot: RAB1B Antibody [NBP1-98500] - Human Fetal Kidney Lysate, concentration 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6879_RAB1B-Antibody-Western-Blot-NBP1-98500-img0002.jpg)