CAPZB Antibody (4H8)

• Supplier: Novus Biologicals
• Catalog: H00000832-M03
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 4H8
• Applications: WB ELISA
• Species Reactivities: Human
• Antigen: CAPZB (NP_004921 192 a.a. - 272 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: CAPZB
• Conjugate: Unconjugated

Product images

Western Blot: CAPZB Antibody (4H8) [H00000832-M03] - Analysis of CAPZB expression in HeLa (Cat # L013V1).

Western Blot: CAPZB Antibody (4H8) [H00000832-M03] - analysis of CAPZB expression in transfected 293T cell line by CAPZB monoclonal antibody (M03), clone 4H8. Lane 1: CAPZB transfected lysate (9 KDa). Lane 2: Non-transfected lysate.

ELISA: CAPZB Antibody (4H8) [H00000832-M03] - Detection limit for recombinant GST tagged CAPZB is approximately 0.1ng/ml as a capture antibody.