P2X4 Antibody
| Name | P2X4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00005025-B01P |
| Prices | $359.00 |
| Sizes | 50 µg |
| Host | Mouse |
| Clonality | Polyclonal |
| Applications | WB FC ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | P2RX4 (NP_002551.2, 1 a.a. - 388 a.a.) full-length human protein. MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ |
| Purity/Format | Protein A purified |
| Description | Mouse Polyclonal |
| Gene | P2RX4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: P2X4 Antibody [H00005025-B01P] - Analysis of P2RX4 expression in transfected 293T cell line by P2RX4 polyclonal antibody. Lane 1: P2RX4 transfected lysate(42.68 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/10913_P2X4%2520Antibody-Western%2520Blot-H00005025-B01P-img0005.jpg)
Western Blot: P2X4 Antibody [H00005025-B01P] - Analysis of P2RX4 expression in transfected 293T cell line by P2RX4 polyclonal antibody. Lane 1: P2RX4 transfected lysate(42.68 KDa). Lane 2: Non-transfected lysate.
![Flow Cytometry: P2X4 Antibody [H00005025-B01P] - Analysis of negative control 293 cells (Black) and P2RX4 expressing 293 cells (Green) using P2RX4 purified mouse polyclonal antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/10914_P2X4-Antibody-Flow-Cytometry-H00005025-B01P-img0004.jpg)
Flow Cytometry: P2X4 Antibody [H00005025-B01P] - Analysis of negative control 293 cells (Black) and P2RX4 expressing 293 cells (Green) using P2RX4 purified mouse polyclonal antibody.
![Western Blot: P2X4 Antibody [H00005025-B01P] - analysis of P2RX4 expression in transfected 293T cell line by P2RX4 MaxPab polyclonal antibody. Lane 1: P2RX4 transfected lysate (42.68 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/10915_P2X4-Antibody-Western-Blot-H00005025-B01P-img0001.jpg)
Western Blot: P2X4 Antibody [H00005025-B01P] - analysis of P2RX4 expression in transfected 293T cell line by P2RX4 MaxPab polyclonal antibody. Lane 1: P2RX4 transfected lysate (42.68 KDa). Lane 2: Non-transfected lysate.