Name | NRAMP1/SLC11A1 Antibody (2G2) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00006556-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 Kappa |
Clone | 2G2 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | SLC11A1 (NP_000569.2 308 a.a. - 350 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | SLC11A1 |
Conjugate | Unconjugated |
Supplier Page | Shop |