DTX4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-32448
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: DSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSP
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: DTX4 Protein
• Description: Rabbit Polyclonal
• Gene: DTX4
• Conjugate: Unconjugated

Product images

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse pons shows strong cytoplasmic positivity in neurons of the motor trigeminal nucleus.

Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448] - Staining of human hippocampus shows moderate granular immunoreactivity in neuronal cell bodies.

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse hippocampus shows restricted positivity in the CA2/CA3 areas.

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse olfactory bulb shows weak staining in the external plexiform layer.

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse pons shows cytoplasmic staining in the vestibular nucleus.

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Immunofluorescent staining of human cell line CACO-2 shows localization to vesicles.

Immunohistochemistry: DTX4 Antibody [NBP2-32448] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448] - Staining of human cerebellum shows strong granular cytoplasmic immunoreactivity in Purkinje cells.