Thyroid receptor-interacting protein 12 Antibody
| Name | Thyroid receptor-interacting protein 12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34035 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Thyroid receptor-interacting protein 12 Protein |
| Description | Rabbit Polyclonal |
| Gene | TRIP12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Thyroid receptor-interacting protein 12 Antibody [NBP2-34035] - Staining of human cell line U-2 OS shows localization to nuclear speckles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6537_Thyroid-receptor-interacting-protein-12-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34035-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Thyroid receptor-interacting protein 12 Antibody [NBP2-34035] - Staining of human cell line U-2 OS shows localization to nuclear speckles.
![Immunohistochemistry-Paraffin: Thyroid receptor-interacting protein 12 Antibody [NBP2-34035] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6538_Thyroid%2520receptor-interacting%2520protein%252012%2520Antibody-Immunohistochemistry-Paraffin-NBP2-34035-img0004.jpg)
Immunohistochemistry-Paraffin: Thyroid receptor-interacting protein 12 Antibody [NBP2-34035] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.