Lgr4/GPR48 Antibody
| Name | Lgr4/GPR48 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89737 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Lgr4/GPR48 Protein |
| Description | Rabbit Polyclonal |
| Gene | LGR4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Lgr4/GPR48 Antibody [NBP1-89737] - Staining of human breast shows strong positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20325_Lgr4-GPR48-Antibody-Immunohistochemistry-NBP1-89737-img0003.jpg)
Immunohistochemistry: Lgr4/GPR48 Antibody [NBP1-89737] - Staining of human breast shows strong positivity in glandular cells.