PHLDA3 Antibody

Name PHLDA3 Antibody
Supplier Novus Biologicals
Catalog NBP1-56772
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PHLDA3(pleckstrin homology-like domain, family A, member 3) The peptide sequence was selected from the N terminal of PHLDA3. Peptide sequence LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PHLDA3
Conjugate Unconjugated
Supplier Page Shop

Product images