OLAH Antibody

Name OLAH Antibody
Supplier Novus Biologicals
Catalog NBP1-56829
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OLAH(oleoyl-ACP hydrolase) The peptide sequence was selected from the N terminal of OLAH. Peptide sequence MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OLAH
Conjugate Unconjugated
Supplier Page Shop

Product images