FAAP Antibody

Name FAAP Antibody
Supplier Novus Biologicals
Catalog NBP1-56856
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C22ORF28 The peptide sequence was selected from the middle region of C22ORF28. Peptide sequence EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RTCB
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.