Exosome component 6 Antibody
| Name | Exosome component 6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57471 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EXOSC6 (exosome component 6) The peptide sequence was selected from the N terminal of Exosome component 6. Peptide sequence LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EXOSC6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Exosome component 6 Antibody [NBP1-57471] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16441_Exosome%2520component%25206%2520Antibody-Western%2520Blot-NBP1-57471-img0003.jpg)
Western Blot: Exosome component 6 Antibody [NBP1-57471] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.