| Name | MSL2L1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52987 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MSL2L1(male-specific lethal 2-like 1 (Drosophila)) The peptide sequence was selected from the N terminal of MSL2L1. Peptide sequence NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MSL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |