| Name | ITGB1BP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53033 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ITGB1BP3(integrin beta 1 binding protein 3) The peptide sequence was selected from the middle region of ITGB1BP3. Peptide sequence YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NMRK2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |