RNF212 Antibody

Name RNF212 Antibody
Supplier Novus Biologicals
Catalog NBP1-55083
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RNF212(ring finger protein 212) The peptide sequence was selected from the middle region of RNF212. Peptide sequence LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RNF212
Conjugate Unconjugated
Supplier Page Shop

Product images