Ficolin-3 Antibody

Name Ficolin-3 Antibody
Supplier Novus Biologicals
Catalog NBP1-58024
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FCN3(ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)) The peptide sequence was selected from the N terminal of FCN3. Peptide sequence LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FCN3
Conjugate Unconjugated
Supplier Page Shop

Product images