Carbohydrate Sulfotransferase 6/CHST6 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57928
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CHST6(carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6) The peptide sequence was selected from the middle region of CHST6. Peptide sequence QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CHST6
• Conjugate: Unconjugated