RBJ Antibody

Name RBJ Antibody
Supplier Novus Biologicals
Catalog NBP1-58940
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RBJ(rab and DnaJ domain containing) The peptide sequence was selected from the middle region of RBJ. Peptide sequence CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DNAJC27
Conjugate Unconjugated
Supplier Page Shop

Product images