IFIT5 Antibody

Name IFIT5 Antibody
Supplier Novus Biologicals
Catalog NBP1-58886
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to IFIT5(interferon-induced protein with tetratricopeptide repeats 5) The peptide sequence was selected from the N terminal of IFIT5. Peptide sequence LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene IFIT5
Conjugate Unconjugated
Supplier Page Shop

Product images