RDH16 Antibody

Name RDH16 Antibody
Supplier Novus Biologicals
Catalog NBP1-58059
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RDH16 (retinol dehydrogenase 16 (all-trans)) The peptide sequence was selected from the middle region of RDH16. Peptide sequence SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RDH16
Conjugate Unconjugated
Supplier Page Shop

Product images