HERC5 Antibody

Name HERC5 Antibody
Supplier Novus Biologicals
Catalog NBP1-58101
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HERC5(hect domain and RLD 5) The peptide sequence was selected from the N terminal of HERC5. Peptide sequence CLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HERC5
Conjugate Unconjugated
Supplier Page Shop

Product images