ORC4L Antibody

Name ORC4L Antibody
Supplier Novus Biologicals
Catalog NBP1-58167
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ORC4L(origin recognition complex, subunit 4-like (yeast)) The peptide sequence was selected from the middle region of ORC4L. Peptide sequence VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ORC4
Conjugate Unconjugated
Supplier Page Shop

Product images