ABCC11 Antibody

Name ABCC11 Antibody
Supplier Novus Biologicals
Catalog NBP1-59810
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ABCC11(ATP-binding cassette, sub-family C (CFTR/MRP), member 11) The peptide sequence was selected from the middle region of ABCC11. Peptide sequence NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ABCC11
Conjugate Unconjugated
Supplier Page Shop

Product images