NDST3 Antibody

Name NDST3 Antibody
Supplier Novus Biologicals
Catalog NBP1-62469
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NDST3(N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3) The peptide sequence was selected from the N terminal of NDST3. Peptide sequence PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NDST3
Conjugate Unconjugated
Supplier Page Shop

Product images